PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5NG584300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 854aa    MW: 93423 Da    PI: 6.0776
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5NG584300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS393.52.2e-1204718402374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          ++lL++cA+ v+++d + a++lL++++++asp+gd  qRla +f+++L+arla+++s++yk++ +++ +    +++l+a++l+  ++P+ 
  Pavir.5NG584300.1.p 471 ETLLIHCAQSVATDDRRGATELLKQIRQHASPNGDGDQRLAYCFANGLEARLAGNGSQIYKSVVMTRFP---CTDVLKAYQLYLAACPFK 557
                          789*****************************************************************9...9***************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefn 179
                          k+sh+ aNq+I++ave++++vHi+D++i +G+QWp+L+q L++ p+gpp+lRiTg++ p++g   +e++eetg+ L+++A++++vpfef+
  Pavir.5NG584300.1.p 558 KISHFFANQTIVNAVEKAKKVHIVDYGIYYGFQWPCLIQRLSTMPGGPPRLRITGIDTPQPGfrPAERIEETGRYLKDYAQTFNVPFEFQ 647
                          ****************************************************************************************** PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                          + + +r+e++++e+L+++++E l+Vn++++l++l++esv  es+r+ vL+++++++P+v+++   + ++n++ F+ rf eal +ysa+fd
  Pavir.5NG584300.1.p 648 A-IPSRFEAVKIEDLHIEKDELLIVNCMFKLKTLMEESVVAESPRNMVLNTIRKMNPHVFIHGIVNGSYNAPFFVSRFREALFHYSAIFD 736
                          *.7*************************************************************************************** PP

                 GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslv 359
                          +le+++pr++e+r  +E++l+gre++nv++ceg er er et+++W+ r ++aGFk++p++++++k a+  +r +++d + ++e++++l+
  Pavir.5NG584300.1.p 737 MLETNIPRDNEQRLLIEAALFGREAMNVISCEGLERMERPETYKQWQVRNRRAGFKQLPINQDIMKRAREKVRCYHKD-FIIDEDNKWLL 825
                          ****************************************************************************77.*********** PP

                 GRAS 360 lgWkdrpLvsvSaWr 374
                          +gWk+r L+++S W+
  Pavir.5NG584300.1.p 826 QGWKGRILLALSTWK 840
                          **************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.515444821IPR005202Transcription factor GRAS
PfamPF035147.7E-118471840IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 854 aa     Download sequence    Send to blast
MVMDAGLHEL CALLPGSNKR DGHLPIYPQI APAANRFTAE DLESLLFVPH DGIAAAAGVG  60
GGYLNVAPTT VVPPASTYQA SPPRDAAAAG GGGYLNVASA TVVPPAPTNT VSPPRDAEAA  120
AAPAAAGQPD DSEAFSDIVL GYINRMLMAE DIDDKFDHYP EHSALLAAEK PFLEILTDQP  180
ASSGGSAVES PDGSSVTNSC NSLGSCSCGA AVSGGFGTLP TPALDLRSAA FLQPPQLYQD  240
LSPESGVVDA GGPWPYDPTE FYQLQPNPVA EALLSQSPSF ASSNCSGVAS SDGFELLLSS  300
SGVMPDVGFT DFVVQSQQAM QFCRGLEEAS KFLPDESKLV IDLEKSTSVA SLVANVKEEK  360
RFAEVKTEKN DIEAAVHRGK KHLYGDDLDA EEGRCSKHSA AAAIDPDHLV REMMDKVLLC  420
NGEMCSKGVK ELREALQHDV AKHSHGGHGK DSGHGKGRGK KQPKKEVIDL ETLLIHCAQS  480
VATDDRRGAT ELLKQIRQHA SPNGDGDQRL AYCFANGLEA RLAGNGSQIY KSVVMTRFPC  540
TDVLKAYQLY LAACPFKKIS HFFANQTIVN AVEKAKKVHI VDYGIYYGFQ WPCLIQRLST  600
MPGGPPRLRI TGIDTPQPGF RPAERIEETG RYLKDYAQTF NVPFEFQAIP SRFEAVKIED  660
LHIEKDELLI VNCMFKLKTL MEESVVAESP RNMVLNTIRK MNPHVFIHGI VNGSYNAPFF  720
VSRFREALFH YSAIFDMLET NIPRDNEQRL LIEAALFGRE AMNVISCEGL ERMERPETYK  780
QWQVRNRRAG FKQLPINQDI MKRAREKVRC YHKDFIIDED NKWLLQGWKG RILLALSTWK  840
PDHKSSMIAE HCK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-544748408375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.167330.0leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970541.10.0PREDICTED: scarecrow-like protein 9
SwissprotO809331e-179SCL9_ARATH; Scarecrow-like protein 9
TrEMBLK3XEB70.0K3XEB7_SETIT; Uncharacterized protein
STRINGSi000234m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP125183137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-179GRAS family protein